PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_001474
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family MIKC_MADS
Protein Properties Length: 206aa    MW: 23477.3 Da    PI: 8.0659
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_001474genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF786.8e-25956148
                 S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEE CS
       SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklye 48
                 krien   rqvtf+kRr+g+lKKA+ELSvLCdae+ v ifs +gkly+
  DCAR_001474  9 KRIENPVHRQVTFCKRRAGLLKKAKELSVLCDAEIGVFIFSAHGKLYD 56
                 79********************************************97 PP

2K-box57.36.9e-2086175998
        K-box   9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 
                  ++e++ +  + e++ Lk ei+ Lq+ +  + G + +++++ eL+ Le++L+  + +iRs K+++++++i+ l++ke+ l+ +n++L+ k+
  DCAR_001474  86 ATEKQVQDTKMEIDVLKTEIDLLQKGLGYMSGGGTGKMTMDELHMLEKNLQVWIDHIRSVKMDIMFQEIQLLKNKEEILRAANHYLSDKM 175
                  678999********************************************************************************9997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF554554.32E-26173IPR002100Transcription factor, MADS-box
SMARTSM004322.1E-35160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006629.17161IPR002100Transcription factor, MADS-box
PRINTSPR004042.6E-26323IPR002100Transcription factor, MADS-box
CDDcd002656.85E-38376No hitNo description
PfamPF003192.4E-221055IPR002100Transcription factor, MADS-box
PRINTSPR004042.6E-262338IPR002100Transcription factor, MADS-box
PRINTSPR004042.6E-263859IPR002100Transcription factor, MADS-box
PfamPF014862.7E-1987175IPR002487Transcription factor, K-box
PROSITE profilePS5129710.63291181IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0048364Biological Processroot development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 206 aa     Download sequence    Send to blast
MVRGKIQMKR IENPVHRQVT FCKRRAGLLK KAKELSVLCD AEIGVFIFSA HGKLYDLATK  60
GTMQGLVNKY LKSTRGADPD VEDCQATEKQ VQDTKMEIDV LKTEIDLLQK GLGYMSGGGT  120
GKMTMDELHM LEKNLQVWID HIRSVKMDIM FQEIQLLKNK EEILRAANHY LSDKMSNQYG  180
FINIDTPVMD NIAYPLTIQN EIYQF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016569788.12e-99PREDICTED: agamous-like MADS-box protein AGL12 isoform X1
SwissprotQ388411e-76AGL12_ARATH; Agamous-like MADS-box protein AGL12
TrEMBLA0A097BTX73e-99A0A097BTX7_TOBAC; TAGL12 transcription factor
STRINGVIT_18s0041g02140.t011e-97(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA98102024
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71692.17e-78AGAMOUS-like 12